{"product_id":"proteintech-26426-1-ap","title":"Proteintech, 26426-1-AP, KCNH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCNH1 (26426-1-AP) by Proteintech is a Polyclonal antibody targeting KCNH1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n26426-1-AP targets KCNH1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat brain tissue\nPositive IHC detected in: rat brain tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPotassium voltage-gated channel subfamily H member 1 (KCNH1, also known as Kv10.1 and EAG) a member of the EAG (ether-à-go-go) family, which is involved in intracellular signaling, cell proliferation, and tumorigenesis (PMID: 35639255). KCNH1 is mainly expressed in the adult central nervous system. It also plays a role in controlling K+ fux that regulates resting membrane potential in excitable and non-excitable cells and is activated at the onset of myoblast differentiation (PMID: 29333676; 27029528; 9738473).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag16647 Product name: Recombinant human KCNH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 686-850 aa of BC113709 Sequence: VKREEEERMKRKNEAPLILPPDHPVRRLFQRFRQQKEARLAAERGGRDLDDLDVEKGNVLTEHASANHSLVKASVVTVRESPATPVSFQAASTSGVPDHAKLQAPGSECLGPKGGGGDCAKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKASGEATLKKT Predict reactive species\nFull Name: potassium voltage-gated channel, subfamily H (eag-related), member 1\nCalculated Molecular Weight: 989 aa, 111 kDa\nObserved Molecular Weight: 111 kDa\nGenBank Accession Number: BC113709\nGene Symbol: KCNH1\nGene ID (NCBI): 3756\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95259\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869700214953,"sku":"26426-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26426-1-ap","provider":"Iright","version":"1.0","type":"link"}