{"product_id":"proteintech-26449-1-ap","title":"Proteintech, 26449-1-AP, NME7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NME7 (26449-1-AP) by Proteintech is a Polyclonal antibody targeting NME7 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26449-1-AP targets NME7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse embryo tissue\nPositive IHC detected in: human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNME7, also named as NDK7, nm23-H7, plays the major role in the synthesis of nucleoside triphosphates other than ATP. NME7 has two isoforms with MW 38-42 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24918 Product name: Recombinant human NME7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of BC006983 Sequence: MNHSERFVFIAEWYDPNASLLRRYELLFYPGDGSVEMHDVKNHRTFLKRTKYDNLHLEDLFIGNKVNVFSRQLVLIDYGDQYTARQLGSR Predict reactive species\nFull Name: non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)\nCalculated Molecular Weight: 376 aa, 42 kDa\nObserved Molecular Weight: 38-42 kDa\nGenBank Accession Number: BC006983\nGene Symbol: NME7\nGene ID (NCBI): 29922\nRRID: AB_2880517\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y5B8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869566849193,"sku":"26449-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26449-1-ap","provider":"Iright","version":"1.0","type":"link"}