{"product_id":"proteintech-26454-1-ap","title":"Proteintech, 26454-1-AP, MOS Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe MOS (26454-1-AP) by Proteintech is a Polyclonal antibody targeting MOS in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n26454-1-AP targets MOS in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells,  HEK-293 cells,  Jurkat cells\nPositive IHC detected in: human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMos is a germ cell-specific serine\/threonine protein kinase, can induce oncogenic transformation of somatic cells by direct phosphorylation of MAP kinase\/ERK kinase (MEK1), activating the mitogen-activated protein kinases ERK1 and ERK2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24585 Product name: Recombinant human MOS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 31-150 aa of BC069569 Sequence: PAKLLLGATLPRAPRLPRRLAWCSIDWEQVCLLQRLGAGGFGSVYKATYRGVPVAIKQVNKCTKNRLASRRSFWAELNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQV Predict reactive species\nFull Name: v-mos Moloney murine sarcoma viral oncogene homolog\nCalculated Molecular Weight: 346 aa, 38 kDa\nObserved Molecular Weight: 34-38 kDa\nGenBank Accession Number: BC069569\nGene Symbol: MOS\nGene ID (NCBI): 4342\nRRID: AB_3085874\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P00540\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887722287273,"sku":"26454-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26454-1-ap","provider":"Iright","version":"1.0","type":"link"}