{"product_id":"proteintech-26455-1-ap","title":"Proteintech, 26455-1-AP, CD85j \/ LILRB1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD85j \/ LILRB1 (26455-1-AP) by Proteintech is a Polyclonal antibody targeting CD85j \/ LILRB1 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples\n26455-1-AP targets CD85j \/ LILRB1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi cells, Ramos cells\nPositive IHC detected in: human liver tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: Ramos cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLILRB1, also named as CD85j or ILT2, includes four C2 Ig domains binding HLA class I molecules in the extracellular region and a cytoplasmic domain containing four immunoreceptor tyrosine-based inhibition motifs (ITIM). LILRB1 is a surface glycoprotein detected on the surface of B cells, monocytes, dendritic cells, T cells and NK cells. The predicted MW of LILRB1 is 71 kDa and 26455-1-AP antibody recognizes the 71 and 110 kDa which might be the noncovalently linked monomer. (PMID:17601702; 15474475; 17549736; 24098421)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24795 Product name: Recombinant human LILRB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 137-241 aa of BC015731 Sequence: SGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEET Predict reactive species\nFull Name: leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1\nCalculated Molecular Weight: 71 kDa\nObserved Molecular Weight: 71 and 110 kDa\nGenBank Accession Number: BC015731\nGene Symbol: LILRB1\nGene ID (NCBI): 10859\nRRID: AB_2880518\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8NHL6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869653520553,"sku":"26455-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26455-1-ap","provider":"Iright","version":"1.0","type":"link"}