{"product_id":"proteintech-26468-1-ap","title":"Proteintech, 26468-1-AP, ERF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERF (26468-1-AP) by Proteintech is a Polyclonal antibody targeting ERF in WB, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n26468-1-AP targets ERF in WB, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, A549 cells,  J774A.1 cells,  RAW 264.7 cells\nPositive IP detected in: A431 cells\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nERF (Ets2 repressor factor) is also named as PE-2. Erf is a gene for a ubiquitously expressed Ets DNA-binding domain-containing transcriptional repressor regulated by Erk-dependent phosphorylation (PMID: 28694332, PMID: 35258130). Erf is involved in T cell maturation, acting as a positive regulator during CD4 and eventually CD8 lineage commitment, while negatively regulates the production of γδ T cells  (PMID: 35258130). Erf is required for both primitive and erythromyeloid progenitor waves of hematopoietic stem cell (HSC)-independent hematopoiesis as well as for the normal function of HSCs (PMID: 28694332). ETS2 repressor factor (ERF) insufficiency causes craniosynostosis (CRS4) in humans and mice. ERF is an ETS domain transcriptional repressor regulated by Erk1\/2 phosphorylation via nucleo-cytoplasmic shuttling (PMID: 37175668).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24189 Product name: Recombinant human ERF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 138-323 aa of BC022231 Sequence: GGSHFRFPPSTPSEVLSPTEDPRSPPACSSSSSSLFSAVVARRLGRGSVSDCSDGTSELEEPLGEDPRARPPGPPDLGAFRGPPLARLPHDPGVFRVYPRPRGGPEPLSPFPVSPLAGPGSLLPPQLSPALPMTPTHLAYTPSPTLSPMYPSGGGGPSGSGGGSHFSFSPEDMKRYLQAHTQSVYN Predict reactive species\nFull Name: Ets2 repressor factor\nCalculated Molecular Weight: 548 aa, 59 kDa\nObserved Molecular Weight: 90 kDa\nGenBank Accession Number: BC022231\nGene Symbol: ERF\nGene ID (NCBI): 2077\nRRID: AB_3669537\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P50548\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887627358377,"sku":"26468-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26468-1-ap","provider":"Iright","version":"1.0","type":"link"}