{"product_id":"proteintech-26472-1-ap","title":"Proteintech, 26472-1-AP, TRMT112 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TRMT112 (26472-1-AP) by Proteintech is a Polyclonal antibody targeting TRMT112 in WB, IHC, ELISA applications with reactivity to human samples\n26472-1-AP targets TRMT112 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, HeLa cells,  K-562 cells,  PC-3 cells,  SH-SY5Y cells\nPositive IHC detected in: human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTRMT112 is a small evolutionarily conserved protein that acts as a co-factor and activator for different MTases involved in rRNA, tRNA and protein methylation. The TRMT112 interaction with 18S rRNA MTases WBSCR22 (BUD23, MERM1) and METTL5 is required for their metabolic stability and enzymatic activity in cells. (PMID: 34948388, PMID: 34948388)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24126 Product name: Recombinant human HSPC152 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 40-125 aa of BC017172 Sequence: NFVARMIPKVEWSAFLEAADNLRLIQVPKGPVEGYEENEEFLRTMHHLLLEVEVIEGTLQCPESGRMFPISRGIPNMLLSEEETES Predict reactive species\nFull Name: hypothetical protein HSPC152\nObserved Molecular Weight: 14 kDa\nGenBank Accession Number: BC017172\nGene Symbol: TRMT112\nGene ID (NCBI): 51504\nRRID: AB_3085875\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UI30\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887839563945,"sku":"26472-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26472-1-ap","provider":"Iright","version":"1.0","type":"link"}