{"product_id":"proteintech-26495-1-ap","title":"Proteintech, 26495-1-AP, EGR3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EGR3 (26495-1-AP) by Proteintech is a Polyclonal antibody targeting EGR3 in WB, ELISA applications with reactivity to human samples\n26495-1-AP targets EGR3 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: L02 cells, PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe early growth response (Egr) family of zinc finger transcription factors regulates critical genetic programs in cellular growth, differentiation, and function. EGR3 (Early Growth Response 3; also known as PILOT) is a member of the early growth response (Egr) gene family of transcription factors. EGR3 regulates the expression of genes involved in inflammation, including genes encoding various secreted cytokines and protease inhibitors. EGR3 functions as a master regulator of genes differentially expressed in the brains of patients with neuropsychiatric illnesses ranging from schizophrenia and bipolar disorder to Alzheimer's disease.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24152 Product name: Recombinant human EGR3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-186 aa of BC104765 Sequence: MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLTNEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGALSTQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAKPALDSN Predict reactive species\nFull Name: early growth response 3\nCalculated Molecular Weight: 387 aa, 43 kDa\nObserved Molecular Weight: 43 kDa\nGenBank Accession Number: BC104765\nGene Symbol: EGR3\nGene ID (NCBI): 1960\nRRID: AB_3669540\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q06889\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887454867625,"sku":"26495-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26495-1-ap","provider":"Iright","version":"1.0","type":"link"}