{"product_id":"proteintech-26503-1-ap","title":"Proteintech, 26503-1-AP, FCRL5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FCRL5 (26503-1-AP) by Proteintech is a Polyclonal antibody targeting FCRL5 in WB, ELISA applications with reactivity to human samples\n26503-1-AP targets FCRL5 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Daudi  cells,  Raji cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFCRL5, also known as CD307 or IRTA2, is a surface protein expressed selectively on B cells and plasma cells (PMID: 11290337). This protein has both an immunoreceptor tyrosine-based activation motif (ITAM)-like sequence and two consensus immunoreceptor tyrosine-based inhibitory motifs (ITIM) in its cytoplasmic region (PMID: 17522256). FCRL5 is implicated in B cell development and lymphomagenesis (PMID: 11290337; 11453668). It may have an immunoregulatory role in marginal zone B-cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24351 Product name: Recombinant human FCRL5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 245-375 aa of BC101067 Sequence: FQITAMWSKDSGFYWCKAATMPYSVISDSPRSWIQVQIPASHPVLTLSPEKALNFEGTKVTLHCETQEDSLRTLYRFYHEGVPLRHKSVRCERGASISFSLTTENSGNYYCTADNGLGAKPSKAVSLSVTV Predict reactive species\nFull Name: Fc receptor-like 5\nCalculated Molecular Weight: 977 aa, 106 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC101067\nGene Symbol: FCRL5\nGene ID (NCBI): 83416\nRRID: AB_2880535\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96RD9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887637975209,"sku":"26503-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26503-1-ap","provider":"Iright","version":"1.0","type":"link"}