{"product_id":"proteintech-26510-1-ap","title":"Proteintech, 26510-1-AP, C13orf1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe C13orf1 (26510-1-AP) by Proteintech is a Polyclonal antibody targeting C13orf1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n26510-1-AP targets C13orf1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: PC-12 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nC13orf1, also named as SPRYD7 and CLLD6, is involved in hematopoiesis via NOTCH signaling. C13orf1 plays an important role in the pathogenesis of B-CLL. There're some isoforms of C13orf1 with MW 15-17 kDa and 19-22 kDa.3\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag23487 Product name: Recombinant human C13orf1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-157 aa of BC022519 Sequence: MATSVLCCLRCCRDGGTGHIPLKEMPAVQLDTQHMGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMHCPASGIRGTVYPVVYDDDSAILDCQFSEFYHTPPPGFEKILFEQQIF Predict reactive species\nFull Name: chromosome 13 open reading frame 1\nObserved Molecular Weight: 17 kDa, 20 kDa\nGenBank Accession Number: BC022519\nGene Symbol: C13orf1\nGene ID (NCBI): 57213\nRRID: AB_2880536\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q5W111\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869645164713,"sku":"26510-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26510-1-ap","provider":"Iright","version":"1.0","type":"link"}