{"product_id":"proteintech-26551-1-ap","title":"Proteintech, 26551-1-AP, Phospholipase C Beta 1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Phospholipase C Beta 1 (26551-1-AP) by Proteintech is a Polyclonal antibody targeting Phospholipase C Beta 1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n26551-1-AP targets Phospholipase C Beta 1 in WB, IHC, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: SH-SY5Y cells, rat brain tissue,  U-251 cells,  mouse brain tissue,  rat tissue\nPositive IHC detected in: human gliomas tissue,  human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPLCB1 catalyzes the formation of inositol 1,4,5-trisphosphate and diacylglycerol from phosphatidylinositol 4,5-bisphosphate. This reaction uses calcium as a cofactor and plays an important role in the intracellular transduction of many extracellular signals. PLCB1 is activated by two G-protein alpha subunits, alpha-q and alpha-11.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rat, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24750 Product name: Recombinant human PLCB1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1162-1216 aa of BC069420 Sequence: LEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSSEELGGDIPGKEFDTPL Predict reactive species\nFull Name: phospholipase C, beta 1 (phosphoinositide-specific)\nCalculated Molecular Weight: 1216 aa, 139 kDa\nObserved Molecular Weight: 139 kDa\nGenBank Accession Number: BC069420\nGene Symbol: PLCB1\nGene ID (NCBI): 23236\nRRID: AB_2861360\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NQ66\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868986495145,"sku":"26551-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26551-1-ap","provider":"Iright","version":"1.0","type":"link"}