{"product_id":"proteintech-26574-1-ap","title":"Proteintech, 26574-1-AP, OAT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe OAT1 (26574-1-AP) by Proteintech is a Polyclonal antibody targeting OAT1 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26574-1-AP targets OAT1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOAT1, also named as SLC22A6, has two GXXXG motifs in its transmembrane which is associated with protein processing and oligomerization of other proteins. OAT1 is involved in the renal elimination of endogenous and exogenous organic anions. It has been reported that OAT1 plays a key role in clearing endogenous metabolites, toxins and drugs from blood. OAT1 has some isoforms and the calculated MW ranges from  55 kDa to 62 kDa. 26574-1-AP antibody detects the 60-65 kDa (native forms) and 70-80 kDa (mature forms) protein in SDS-PAGE. (PMID: 21340049, 23389457, 23196129)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24234 Product name: Recombinant human SLC22A6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 476-550 aa of BC033682 Sequence: SMTAELYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL Predict reactive species\nFull Name: solute carrier family 22 (organic anion transporter), member 6\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 60-65 and 70-80 kDa\nGenBank Accession Number: BC033682\nGene Symbol: OAT1\nGene ID (NCBI): 9356\nRRID: AB_2880557\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q4U2R8\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868859289769,"sku":"26574-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26574-1-ap","provider":"Iright","version":"1.0","type":"link"}