{"product_id":"proteintech-26583-1-ap","title":"Proteintech, 26583-1-AP, DNA ligase III\/LIG3 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DNA ligase III\/LIG3 (26583-1-AP) by Proteintech is a Polyclonal antibody targeting DNA ligase III\/LIG3 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n26583-1-AP targets DNA ligase III\/LIG3 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, HeLa cells,  PC-3 cells\nPositive IP detected in: HEK-293T cells\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDNA ligase III(DNA ligase 3) is an enzyme that in humans is encoded by the LIG3 gene. The human LIG3 gene encodes ATP-dependent DNA ligases that seal interruptions in the phosphodiester backbone of duplex DNA. There are three families of ATP-dependent DNA ligases in eukaryotes. These enzymes utilize the same three step reaction mechanism; 1 formation of a covalent enzyme-adenylate intermediate; 2 transfer of the adenylate group to the 5' phosphate terminus of a DNA nick; 3 phosphodiester bond formation. Unlike LIG1 and LIG4 family members that are found in almost all eukaryotes, LIG3 family members are less widely distributed. The LIG3 gene encodes several distinct DNA ligase species by alternative translation initiation and alternative splicing mechanisms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24998 Product name: Recombinant human LIG3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 254-390 aa of BC068005 Sequence: CDPRHKDCLLREFRKLCAMVADNPSYNTKTQIIQDFLRKGSAGDGFHGDVYLTVKLLLPGVIKTVYNLNDKQIVKLFSRIFNCNPDDMARDLEQGDVSETIRVFFEQSKSFPPAAKSLLTIQEVDEFLLRLSKLTKE Predict reactive species\nFull Name: ligase III, DNA, ATP-dependent\nCalculated Molecular Weight: 100-110 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC068005\nGene Symbol: LIG3\nGene ID (NCBI): 3980\nRRID: AB_2880562\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P49916\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868954382505,"sku":"26583-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26583-1-ap","provider":"Iright","version":"1.0","type":"link"}