{"product_id":"proteintech-26590-1-ap","title":"Proteintech, 26590-1-AP, KCC4\/SLC12A7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe KCC4\/SLC12A7 (26590-1-AP) by Proteintech is a Polyclonal antibody targeting KCC4\/SLC12A7 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n26590-1-AP targets KCC4\/SLC12A7 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: BGC-823 cells, NCI-H1299 cells,  Raji cells,  SH-SY5Y cells\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKCC4, also named as Solute carrier family 12 member 7(SLC12A7), is a 1083 amino-acid protein, which belongs to the SLC12A transporter family. As a multi-pass membrane protein, the molecular weight of KCC4 is 119 kDa. KCC4 mediates electroneutral potassium-chloride cotransport when activated by cell swelling. Moreover, KCC4 may mediate K+ uptake into Deiters' cells in the cochlea and contribute to K+ recycling in the inner ear. KCC4 is important for the survival of cochlear outer and inner hair cells and the maintenance of the organ of Corti(Uniprot, GeneID:10723).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24954 Product name: Recombinant human SLC12A7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 953-1004 aa of BC098390 Sequence: IHDRNTASHTAAAARTQAPPTPDKVQMTWTREKLIAEKYRSRDTSLSGFKDL Predict reactive species\nFull Name: solute carrier family 12 (potassium\/chloride transporters), member 7\nObserved Molecular Weight: 119 kDa\nGenBank Accession Number: BC098390\nGene Symbol: KCC4\/SLC12A7\nGene ID (NCBI): 10723\nRRID: AB_2918103\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y666\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887690600617,"sku":"26590-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26590-1-ap","provider":"Iright","version":"1.0","type":"link"}