{"product_id":"proteintech-26592-1-ap","title":"Proteintech, 26592-1-AP, Cardiac Troponin T Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cardiac Troponin T (26592-1-AP) by Proteintech is a Polyclonal antibody targeting Cardiac Troponin T in WB, IHC, IF-P, ELISA applications with reactivity to human,  mouse,  rat samples\n26592-1-AP targets Cardiac Troponin T in WB, IHC, IF-P, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, rat heart tissue\nPositive IHC detected in: human heart tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse heart tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24911 Product name: Recombinant human cTnT protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-76 aa of BC002653 Sequence: MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVP Predict reactive species\nFull Name: troponin T type 2 (cardiac)\nCalculated Molecular Weight: 36 kDa\nObserved Molecular Weight: 34-40 kDa\nGenBank Accession Number: BC002653\nGene Symbol: Cardiac Troponin T\nGene ID (NCBI): 7139\nRRID: AB_2880566\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P45379\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868939276457,"sku":"26592-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26592-1-ap","provider":"Iright","version":"1.0","type":"link"}