{"product_id":"proteintech-26599-1-ap","title":"Proteintech, 26599-1-AP, ELOVL5 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ELOVL5 (26599-1-AP) by Proteintech is a Polyclonal antibody targeting ELOVL5 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n26599-1-AP targets ELOVL5 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  mouse kidney tissue,  rat kidney tissue\nPositive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells, HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nVery long-chain fatty acid elongase 5 (ELOVL5) is a key enzyme for the endogenous synthesis of long-chain unsaturated fatty acids. A critical role of ELOVL5 in elongating fatty acid substrates ranging from 16 to 20 carbons was reported in humans and rodents (PMID: 29454701). ELOVL5 is involved in metastasis through lipid droplets-regulated TGF-β receptor expression and is a predictive biomarker of metastatic ER+ breast cancer (PMID: 36056008). Western blot analysis detected ELOVL51 at an apparent molecular mass of ~25 kDa (PMID: 36056008, 32527375).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24786 Product name: Recombinant human ELOVL5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-104 aa of BC017270 Sequence: CTFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKDHQNGSMAAVNGHTNSFSPLENNVKPRKLRKD Predict reactive species\nFull Name: ELOVL family member 5, elongation of long chain fatty acids (FEN1\/Elo2, SUR4\/Elo3-like, yeast)\nCalculated Molecular Weight: 299 aa, 35 kDa\nObserved Molecular Weight: 25 kDa\nGenBank Accession Number: BC017270\nGene Symbol: ELOVL5\nGene ID (NCBI): 60481\nRRID: AB_3669551\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NYP7\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887519715497,"sku":"26599-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26599-1-ap","provider":"Iright","version":"1.0","type":"link"}