{"product_id":"proteintech-26601-1-ap","title":"Proteintech, 26601-1-AP, SLC40A1\/FPN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC40A1\/FPN1 (26601-1-AP) by Proteintech is a Polyclonal antibody targeting SLC40A1\/FPN1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n26601-1-AP targets SLC40A1\/FPN1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells, mouse spleen tissue,  HepG2 cells,  mouse liver tissue,  rat spleen,  HEK-293T cells,  SW480 cells\nPositive IHC detected in: human liver tissue, mouse spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC40A1, also named as Ferroportin 1 (FPN1), is an iron transporter which is involved in iron export from duodenal epithelial cell and also in transfer of iron between maternal and fetal circulation. It has been reported that SLC40A1 mutations may lead to macrophage iron overload, hyperferritinemia, and normal transferrin saturation among ferroportin iron overload patients. This antibody detects 50-75  kDa protein as well as the fragments of 56 kDa and 35 kDa protein similar to papers in SDS-PAGE (PMID:32645092, 21396368,16054062, 18974313). SLC40A1 is mainly localized to the cell membrane, but may also be detected in the cytoplasm.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig, chicken, zebrafish, bovine, sheep\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24273 Product name: Recombinant human SLC40A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 398-500 aa of BC037733 Sequence: LDLSVSPFEDIRSRFIQGESITPTKIPEITTEIYMSNGSNSANIVPETSPESVPIISVSLLFAGVIAARIGLWSFDLTVTQLLQENVIESERGIINGVQNSMN Predict reactive species\nFull Name: solute carrier family 40 (iron-regulated transporter), member 1\nCalculated Molecular Weight: 62 kDa\nObserved Molecular Weight: 62-70 kDa\nGenBank Accession Number: BC037733\nGene Symbol: SLC40A1\/Ferroportin\nGene ID (NCBI): 30061\nRRID: AB_2880571\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NP59\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868827177129,"sku":"26601-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26601-1-ap","provider":"Iright","version":"1.0","type":"link"}