{"product_id":"proteintech-26604-1-ap","title":"Proteintech, 26604-1-AP, PANX2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PANX2 (26604-1-AP) by Proteintech is a Polyclonal antibody targeting PANX2 in WB, IHC, ELISA applications with reactivity to human,  mouse samples\n26604-1-AP targets PANX2 in WB, IHC, ELISA applications and shows reactivity with human,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse lung tissue,  mouse spleen tissue,  PC-3 cells\nPositive IHC detected in: human skeletal muscle tissue,  human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPannexins (Panx) are proteins homologous to the invertebrate gap junction proteins called innexins (Inx) and are traditionally described as transmembrane channels. Three distinct Panx paralogs (Panx1, Panx2 and Panx3) have been identified in vertebrates. Previous reports on Panx expression and functionality are focused primarily on Panx1 and Panx3 proteins. The exact function of Panx2 remains elusive. Catalog#26604-1-AP specially recognizes the 70 kDa Panx2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24256 Product name: Recombinant human PANX2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 70-170 aa of BC101023 Sequence: ESDLMYDNVVRQLLAALAQSNHDATPTVRDSGVQTVDPSANPAEPDGAAEPPVVKRPRKKMKWIPTSNPLPQPFKEPLAIMRVENSKAEKPKPARRKTATD Predict reactive species\nFull Name: pannexin 2\nCalculated Molecular Weight: 677 aa, 74 kDa\nObserved Molecular Weight: 70 kDa\nGenBank Accession Number: BC101023\nGene Symbol: PANX2\nGene ID (NCBI): 56666\nRRID: AB_2880572\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96RD6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869570224297,"sku":"26604-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26604-1-ap","provider":"Iright","version":"1.0","type":"link"}