{"product_id":"proteintech-26614-1-ap","title":"Proteintech, 26614-1-AP, CCL4\/MIP-1 beta Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CCL4\/MIP-1 beta (26614-1-AP) by Proteintech is a Polyclonal antibody targeting CCL4\/MIP-1 beta in WB, ELISA applications with reactivity to human samples\n26614-1-AP targets CCL4\/MIP-1 beta in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PMA, LPS and Brefeldin A treated THP-1 cells, Transfected HEK-293 cells\nPositive IF\/ICC detected in: PMA, LPS and Brefeldin A treated THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCCL4, also known as Macrophage inflammatory protein-1β (MIP-1β), is a CC chemokine with specificity for CCR5 receptors, and is one of the major HIV-suppressive factors produced by CD8+ T-cells. MIP-1β is an acidic protein composed of 69 amino acids that is produced by many cells, particularly macrophages, dendritic cells, and lymphocytes. MIP-1β is responsible for the activation of PMN and is involved in acute neutrophilic inflammation. Recombinant MIP-1β induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25070 Product name: Recombinant human CCL4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-92 aa of BC107433 Sequence: APMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN Predict reactive species\nFull Name: chemokine (C-C motif) ligand 4\nCalculated Molecular Weight: 92 aa, 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC107433\nGene Symbol: CCL4\/MIP-1 beta\nGene ID (NCBI): 6351\nRRID: AB_3669554\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P13236\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46886017892521,"sku":"26614-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26614-1-ap","provider":"Iright","version":"1.0","type":"link"}