{"product_id":"proteintech-26661-1-ap","title":"Proteintech, 26661-1-AP, EGFL7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe EGFL7 (26661-1-AP) by Proteintech is a Polyclonal antibody targeting EGFL7 in WB, IHC, ELISA applications with reactivity to human samples\n26661-1-AP targets EGFL7 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: COLO 320 cells, K-562 cells,  RKO cells\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEpidermal growth factor-like protein 7 (EGFL7, also known as MEGF7, ZNEU1, and VE-STATIN) is a proangiogenic factor that has been widely described as having a vital role in tubulogenesis and regulation of angiogenesis, mainly during embryogenesis organogenesis (PMID: 22160377; 15162510). It also can reduce central nervous system inflammation and may play a role in tumorigenesis (PMID: 29483510; 37490307).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24693 Product name: Recombinant human EGFL7 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 141-273 aa of BC012377 Sequence: CSARRGGCPQRCINTAGSYWCQCWEGHSLSADGTLCVPKGGPPRVAPNPTGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKDS Predict reactive species\nFull Name: EGF-like-domain, multiple 7\nCalculated Molecular Weight: 273 aa, 30 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC012377\nGene Symbol: EGFL7\nGene ID (NCBI): 51162\nRRID: AB_3669560\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UHF1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887436026025,"sku":"26661-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26661-1-ap","provider":"Iright","version":"1.0","type":"link"}