{"product_id":"proteintech-26689-1-ap","title":"Proteintech, 26689-1-AP, CYR61\/CCN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CYR61\/CCN1 (26689-1-AP) by Proteintech is a Polyclonal antibody targeting CYR61\/CCN1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human samples\n26689-1-AP targets CYR61\/CCN1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, MDA-MB-453s cells,  HeLa cells\nPositive IP detected in: HeLa cells\nPositive IHC detected in: human colon cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A431 cells, MCF-7 cells\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCYR61 is a member of the CYR61\/CTGF\/NOV (CCN) protein family. CYR61 participated in cell mitogenesis, cellular adhesion, migration, differentiation, angiogenesis, and survival. Cyr61 is especially associated with diseases related to chronic inﬂammation, including RA, Crohn's disease and ulcerative colitis. CYR61 may serve essential roles as either an oncogene or a tumor suppressor, depending on the cancer cell type. CYR61 also induces angiogenesis, which supplies oxygen and nutrients to tumors during growth. CYR61 can also play a role in the proliferation, invasion, survival, and metastasis of cancer cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25129 Product name: Recombinant human CYR61 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 165-239 aa of BC001271 Sequence: EDSIKDPMEDQDGLLGKELGFDASEVELTRNNELIAVGKGSSLKRLPVFGMEPRILYNPLQGQKCIVQTTSWSQC Predict reactive species\nFull Name: cysteine-rich, angiogenic inducer, 61\nCalculated Molecular Weight: 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC001271\nGene Symbol: CYR61\nGene ID (NCBI): 3491\nRRID: AB_2880604\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O00622\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868847657129,"sku":"26689-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26689-1-ap","provider":"Iright","version":"1.0","type":"link"}