{"product_id":"proteintech-26704-1-ap","title":"Proteintech, 26704-1-AP, FLVCR2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FLVCR2 (26704-1-AP) by Proteintech is a Polyclonal antibody targeting FLVCR2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n26704-1-AP targets FLVCR2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse liver tissue, rat liver\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24928 Product name: Recombinant human FLVCR2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 476-526 aa of BC019087 Sequence: FLTLGAALTAFIKADLRRQKANKETLENKLQEEEEESNTSKVPTAVSEDHL Predict reactive species\nFull Name: feline leukemia virus subgroup C cellular receptor family, member 2\nCalculated Molecular Weight: 526 aa, 57 kDa\nObserved Molecular Weight: 65-70 kDa\nGenBank Accession Number: BC019087\nGene Symbol: FLVCR2\nGene ID (NCBI): 55640\nRRID: AB_2918106\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UPI3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869684322473,"sku":"26704-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26704-1-ap","provider":"Iright","version":"1.0","type":"link"}