{"product_id":"proteintech-26715-1-ap","title":"Proteintech, 26715-1-AP, GDF11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GDF11 (26715-1-AP) by Proteintech is a Polyclonal antibody targeting GDF11 in WB, IHC, FC (Intra), ELISA applications with reactivity to human samples\n26715-1-AP targets GDF11 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: K-562 cells\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25107 Product name: Recombinant human GDF11 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 299-407 aa of NM_005811 Sequence: NLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS Predict reactive species\nFull Name: growth differentiation factor 11\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 45 kDa\nGenBank Accession Number: NM_005811\nGene Symbol: GDF11\nGene ID (NCBI): 10220\nRRID: AB_2918107\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95390\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868998226089,"sku":"26715-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26715-1-ap","provider":"Iright","version":"1.0","type":"link"}