{"product_id":"proteintech-26739-1-ap","title":"Proteintech, 26739-1-AP, TGR5\/GPBAR1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TGR5\/GPBAR1 (26739-1-AP) by Proteintech is a Polyclonal antibody targeting TGR5\/GPBAR1 in WB, ELISA applications with reactivity to human samples\n26739-1-AP targets TGR5\/GPBAR1 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Caco-2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTGR5, also known as GPBAR1 (G-protein coupled bile acid receptor 1) or M-BAR, is a cell-surface receptor for bile acid which belongs to the G-protein coupled receptor 1 family (20236244). TGR5 gene expression is widely distributed, including endocrine glands, adipocytes, muscles, immune organs, spinal cord, and the enteric nervous system (24411485, 20665558, 22521118). TGR5 activation has some important biological effects such as anti-inflammatory, energy homeostasis and metabolism, anti-apoptotic, and choleretic functions (24411485, 22521118). In addition, TGR5 is related to several diseases, such as Metabolic and cardiovascular disorders, Hepatic and pancreatic disorders, Inflammatory bowel diseases, Gastrointestinal cancer, and so on (24411485).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24893 Product name: Recombinant human GPBAR1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 250-330 aa of BC033625 Sequence: AYEQRPPLGPGTLLSLLSLGSASAAAVPVAMGLGDQRYTAPWRAAAQRCLQGLWGRASRDSPGPSIAYHPSSQSSVDLDLN Predict reactive species\nFull Name: G protein-coupled bile acid receptor 1\nCalculated Molecular Weight: 35 kDa\nObserved Molecular Weight: 32 kDa\nGenBank Accession Number: BC033625\nGene Symbol: GPBAR1\nGene ID (NCBI): 151306\nRRID: AB_3669565\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDU6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869436825769,"sku":"26739-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26739-1-ap","provider":"Iright","version":"1.0","type":"link"}