{"product_id":"proteintech-26751-1-ap","title":"Proteintech, 26751-1-AP, SFRS11 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SFRS11 (26751-1-AP) by Proteintech is a Polyclonal antibody targeting SFRS11 in WB, IHC, ELISA applications with reactivity to human, rat samples\n26751-1-AP targets SFRS11 in WB, IHC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells\nPositive IHC detected in: human breast cancer tissue, rat colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25015 Product name: Recombinant human SFRS11 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 398-483 aa of BC040436 Sequence: KKKSKDKEKDRERKSESDKDVKVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMDMSD Predict reactive species\nFull Name: splicing factor, arginine\/serine-rich 11\nCalculated Molecular Weight: 483 aa, 53 kDa\nObserved Molecular Weight: 68 kDa\nGenBank Accession Number: BC040436\nGene Symbol: SFRS11\nGene ID (NCBI): 9295\nRRID: AB_3085902\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q05519\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887798636713,"sku":"26751-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26751-1-ap","provider":"Iright","version":"1.0","type":"link"}