{"product_id":"proteintech-26757-1-ap","title":"Proteintech, 26757-1-AP, LIF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe LIF (26757-1-AP) by Proteintech is a Polyclonal antibody targeting LIF in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human, mouse samples\n26757-1-AP targets LIF in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: MCF-7 cells, U-87 MG cells\nPositive IHC detected in: human lung cancer tissue, mouse embryo tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: mouse embryo tissue\nPositive IF\/ICC detected in: A431 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLIF is a pleiotropic cytokine with roles in several different systems. It is involved in the induction of hematopoietic differentiation in normal and myeloid leukemia cells, induction of neuronal cell differentiation, regulator of mesenchymal to epithelial conversion during kidney development, and may also have a role in immune tolerance at the maternal-fetal interface. LIF is a glycoprotein with variable molecular weight (38-67 kDa) due to differential glycosylation. (PMID: 8262236, PMID: 35204717)\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25076 Product name: Recombinant human LIF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 27-202 aa of BC093733 Sequence: ITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF Predict reactive species\nFull Name: leukemia inhibitory factor (cholinergic differentiation factor)\nCalculated Molecular Weight: 202 aa, 22 kDa\nObserved Molecular Weight: 22 kDa, 32 kDa\nGenBank Accession Number: BC093733\nGene Symbol: LIF\nGene ID (NCBI): 3976\nRRID: AB_2880624\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P15018\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868873937065,"sku":"26757-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26757-1-ap","provider":"Iright","version":"1.0","type":"link"}