{"product_id":"proteintech-26766-1-ap","title":"Proteintech, 26766-1-AP, ARHGAP28 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ARHGAP28 (26766-1-AP) by Proteintech is a Polyclonal antibody targeting ARHGAP28 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26766-1-AP targets ARHGAP28 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: C2C12 cells, mouse testis tissue\nPositive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nARHGAP28 (Rho GTPase Activating Protein 28), also known as FLJ10312 and KIAA1314, is a Rho GTPase activating protein (RhoGAP) that switches RhoA to its inactive form. It is reported that high expression of ARHGAP28 in osteosarcoma cell lines can inhibit the proliferation, migration, and invasion of osteosarcoma(PMID: 38041020).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25293 Product name: Recombinant human ARHGAP28 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-167 aa of BC065274 Sequence: MNELPRDTCGNHTNQLDGTKEERELPRVIKTSGSMPDDASLNSTTLSDASQDKEGSFAVPRSDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEKNIPPEAEELSFEVSYSEMVTEALKRNKLKKSEIKKEDYVLTKFNVQKTRFGLTEAGDLSAEDMKKIR Predict reactive species\nFull Name: Rho GTPase activating protein 28\nObserved Molecular Weight: 82-90kDa\nGenBank Accession Number: BC065274\nGene Symbol: ARHGAP28\nGene ID (NCBI): 79822\nRRID: AB_3669567\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: B4DXL2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869638709417,"sku":"26766-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26766-1-ap","provider":"Iright","version":"1.0","type":"link"}