{"product_id":"proteintech-26783-1-ap","title":"Proteintech, 26783-1-AP, NaPi-IIa Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe NaPi-IIa (26783-1-AP) by Proteintech is a Polyclonal antibody targeting NaPi-IIa in WB, ELISA applications with reactivity to human,  mouse, rat samples\n26783-1-AP targets NaPi-IIa in WB, ELISA applications and shows reactivity with human,  mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse kidney tissue, mouse lung tissue,  rat kidney tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNaPi-IIa, also known as Npt2a (SLC34A1), is an electrogenic Na+-dependent Pi cotransporter expressed in the brush border membranes (BBM) of renal proximal tubules. NaPi-IIa could be detected with an apparent molecular weight 75 kDa, corresponding to the full length glycosylated protein, together with a lower molecular weight 37 kDa known to be a N-terminal proteolytic fragment which is also glycosylated (PMID:36074191).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24807 Product name: Recombinant human SLC34A1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-103 aa of BC053349 Sequence: MLSYGERLGSPAVSPLPVRGGHVMRGTAFAYVPSPQVLHRIPGTSAYAFPSLGPVALAEHTCPCGEVLERHEPLPAKLALEEEQKPESRLVPKLRQAGAMLLK Predict reactive species\nFull Name: solute carrier family 34 (sodium phosphate), member 1\nObserved Molecular Weight: 70-75 kDa, 30-35 kDa\nGenBank Accession Number: BC053349\nGene Symbol: SLC34A1\nGene ID (NCBI): 6569\nRRID: AB_3085903\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q06495\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887732150441,"sku":"26783-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26783-1-ap","provider":"Iright","version":"1.0","type":"link"}