{"product_id":"proteintech-26789-1-ap","title":"Proteintech, 26789-1-AP, GRLF1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GRLF1 (26789-1-AP) by Proteintech is a Polyclonal antibody targeting GRLF1 in WB, IHC, ELISA applications with reactivity to human samples\n26789-1-AP targets GRLF1 in WB, IF, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, HeLa cells\nPositive IHC detected in: human colon tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGRLF1 is also named as ARHGAP35, p190ARHOGAP, KIAA1722, P190A and GRF1. GRLF1 is a kind of Rho GTPase-activating protein, and it binds several acidic phospholipids which inhibits the Rho GAP activity to promote the Rac GAP activity (PMID:19673492). This binding is inhibited by phosphorylation by PRKCA (PMID:19673492). GRLF1 is Involved in cell differentiation as well as cell adhesion and migration. And it plays an important role in retinal tissue morphogenesis, neural tube fusion, midline fusion of the cerebral hemispheres and mammary gland branching morphogenesis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25353 Product name: Recombinant human GRLF1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 890-1080 aa of BC150257 Sequence: DGAVDVLDNDLSREQLTEGEEIAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEACSTTEEVFNSPRAGSPLCNSNLQDSEEDIEPSYSLFREDTSLPSLSKDHSKLSMELEGNDGLSFIMSNFESKLNNKVPPPVKPKPPVHFEITKGDLSYLDQGHRDGQRKSVSSSPWLPQD Predict reactive species\nFull Name: glucocorticoid receptor DNA binding factor 1\nObserved Molecular Weight: 172 kDa\nGenBank Accession Number: BC150257\nGene Symbol: GRLF1\nGene ID (NCBI): 2909\nRRID: AB_2880636\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9NRY4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869409628329,"sku":"26789-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26789-1-ap","provider":"Iright","version":"1.0","type":"link"}