{"product_id":"proteintech-26791-1-ap","title":"Proteintech, 26791-1-AP, CXCL2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CXCL2 (26791-1-AP) by Proteintech is a Polyclonal antibody targeting CXCL2 in WB, ELISA applications with reactivity to human, mouse, rat samples\n26791-1-AP targets CXCL2 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, human milk,  rat lung tissue,  mouse lung tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCXCL2, also known as macrophage inflammatory protein 2-alpha (MIP2-alpha), is a member of CXC chemokine family that binds to CXC chemokine receptor 2 (CXCR2). CXCL2 is mainly produced by macrophages, endothelial cells, epithelial cells and tumor cells. CXCL2 plays important roles in various biological progresses such as angiogenesis, inflammation, immune response and cancer biological behaviors. Under inflammatory conditions in CNS, microglia and astrocytes may secrete CXCL2 as well as other chemokines, which induces chemotaxis and infiltration of circulatory neutrophils. Indeed, previous studies suggest that CXCL2 is involved in Alzheimer disease, multiple sclerosis and brain ischemia.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25376 Product name: Recombinant human CXCL2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 35-107 aa of BC015753 Sequence: APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN Predict reactive species\nFull Name: chemokine (C-X-C motif) ligand 2\nCalculated Molecular Weight: 107 aa, 11 kDa\nObserved Molecular Weight: 11 kDa\nGenBank Accession Number: BC015753\nGene Symbol: CXCL2\nGene ID (NCBI): 2920\nRRID: AB_3085904\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P19875\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868924006569,"sku":"26791-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26791-1-ap","provider":"Iright","version":"1.0","type":"link"}