{"product_id":"proteintech-26807-1-ap","title":"Proteintech, 26807-1-AP, TREK1\/KCNK2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TREK1\/KCNK2 (26807-1-AP) by Proteintech is a Polyclonal antibody targeting TREK1\/KCNK2 in WB, IHC, ELISA applications with reactivity to human samples\n26807-1-AP targets TREK1\/KCNK2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: LNCaP cells, SH-SY5Y cells\nPositive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe tandem of pore domains in a weak inward rectifying K+ channel (TWIK1, K2P1.1, or KCNK1) and TWIK-related K+channel 1 (TREK1, K2P 2.1, or KCNK2) are members of the two pore domain potassium (K2P) channel family, consisting of 15 channels that regulate the stabilization of resting membrane potential and cellular excitability by wielding background K+ leakage currents (PMID:12580339). TREK1\/KCNK2 is sensitive to a wide range of physical and chemical cues. Its main role is to maintain the resting potential of the cell and whilst highly expressed in the nervous system, TREK1\/KCNK2 is also expressed in the kidney, heart, lung and smooth muscle cells (PMID:31031627).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25209 Product name: Recombinant human KCNK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 18-55 aa of BC101693 Sequence: PRLSFSTKPTVLASRVESDTTINVMKWKTVSTIFLVVV Predict reactive species\nFull Name: potassium channel, subfamily K, member 2\nCalculated Molecular Weight: 411 aa, 46 kDa\nObserved Molecular Weight: 40-50 kDa\nGenBank Accession Number: BC101693\nGene Symbol: TREK1\nGene ID (NCBI): 3776\nRRID: AB_3085905\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O95069\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887837958313,"sku":"26807-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26807-1-ap","provider":"Iright","version":"1.0","type":"link"}