{"product_id":"proteintech-26818-1-ap","title":"Proteintech, 26818-1-AP, TP53RK Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TP53RK (26818-1-AP) by Proteintech is a Polyclonal antibody targeting TP53RK in WB, IP, IHC, ELISA applications with reactivity to human samples\n26818-1-AP targets TP53RK in WB, IP, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HepG2 cells\nPositive IP detected in: Jurkat cells\nPositive IHC detected in: human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25326 Product name: Recombinant human TP53RK protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 154-253 aa of BC009727 Sequence: HDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG Predict reactive species\nFull Name: TP53 regulating kinase\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC009727\nGene Symbol: TP53RK\nGene ID (NCBI): 112858\nRRID: AB_2880647\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q96S44\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869780103337,"sku":"26818-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26818-1-ap","provider":"Iright","version":"1.0","type":"link"}