{"product_id":"proteintech-26824-1-ap","title":"Proteintech, 26824-1-AP, CPA4 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CPA4 (26824-1-AP) by Proteintech is a Polyclonal antibody targeting CPA4 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26824-1-AP targets CPA4 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, SMMC-7721 cells,  mouse kidney tissue,  A549 cells,  HepG2 cells\nPositive IHC detected in: human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:100-1:400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCarboxypeptidase A4 (CPA4), a member of the metallocarboxypeptidase family, is a zinc-containing exopeptidase that catalyzes the release of carboxy-terminal amino acids. CPA4 was previously shown to play a crucial role in cell growth and differentiation by modulating or inactivating peptide hormone activity (PMID: 27904708). CPA4 expression is increased in multiple cancer tissues, including tissues from patients with pancreatic cancer, gastric cancer, esophageal squamous cell carcinoma, and lung cancer, and may serve as a potential diagnostic and prognostic marker (PMID: 31397502, 32922037).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25327 Product name: Recombinant human CPA4 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 316-384 aa of BC052289 Sequence: YPYGYSVKKAPDAEELDKVARLAAKALASVSGTEYQVGPTCTTVYPASGSSIDWAYDNGIKFAFTFELR Predict reactive species\nFull Name: carboxypeptidase A4\nCalculated Molecular Weight: 421 aa, 47 kDa\nObserved Molecular Weight: 44 kDa, 150 kDa\nGenBank Accession Number: BC052289\nGene Symbol: CPA4\nGene ID (NCBI): 51200\nRRID: AB_2880648\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9UI42\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868995965097,"sku":"26824-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26824-1-ap","provider":"Iright","version":"1.0","type":"link"}