{"product_id":"proteintech-26831-1-ap","title":"Proteintech, 26831-1-AP, HAPLN1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HAPLN1 (26831-1-AP) by Proteintech is a Polyclonal antibody targeting HAPLN1 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n26831-1-AP targets HAPLN1 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse placenta tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: U2OS cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHAPLN1 (hyaluronan and proteoglycan link protein 1), also known as CRTL1. It is expected to be located in the cytoplasm and extracellular, and the protein is mainly expressed in placenta and small intestine. The calculated molecular weight of HAPLN1 is 40 kDa. HAPLN1 binds to aggrecan on the hyaluronic chain, stabilizing the aggregates and thus increasing compression resistance and shock absorption. HAPLN1 also functions as a growth factor, up regulating aggrecan and type II collagen synthesis in cartilage. It seems to be an essential part of cartilage homeostasis and may also contribute to homeostasis in the disc tissue (PMID: 23537453).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25221 Product name: Recombinant human HAPLN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 16-131 aa of BC057808 Sequence: DHLSDNYTLDHDRAIHIQAENGPHLLVEAEQAKVFSHRGGNVTLPCKFYRDPTAFGSGIHKIRIKWTKLTSDYLKEVDVFVSMGYHKKTYGGYQGRVFLKGGSDSDASLVITDLTL Predict reactive species\nFull Name: hyaluronan and proteoglycan link protein 1\nCalculated Molecular Weight: 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC057808\nGene Symbol: HAPLN1\nGene ID (NCBI): 1404\nRRID: AB_3669570\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P10915\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887663042729,"sku":"26831-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26831-1-ap","provider":"Iright","version":"1.0","type":"link"}