{"product_id":"proteintech-26847-1-ap","title":"Proteintech, 26847-1-AP, TIMP1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe TIMP1 (26847-1-AP) by Proteintech is a Polyclonal antibody targeting TIMP1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n26847-1-AP targets TIMP1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A2780 cells, HT-29 cells,  SKOV-3 cells\nPositive IHC detected in: mouse colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: SKOV-3 cells, HT-29 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTIMP1 is a member of the family of matrix metalloproteinase inhibitors, which contains four members (TIMP1, TIMP2, TIMP3, and TIMP4). Tissue inhibitors of metalloproteinases (TIMPs) are multifaceted molecules that exhibit properties beyond their classical proteinase inhibitory function. TIMP1 has several MMP-independent functions such as modulation of angiogenesis, promotion of cell proliferation, and inhibition of apoptosis. TIMP1 plays important role in cell cycle regulation and cancer progression. Recently, clinical studies have shown that the aberrant expression of TIMP1 is associated with an unfavorable prognosis in a series of tumors, such as gastric cancer, papillary thyroid carcinoma, cutaneous melanoma and breast cancer. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium. In pregnancy, TIMP1 plays a regulatory role in the process of implantation, particularly the cytotrophoblast invasion of the uterine endometrium.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25395 Product name: Recombinant human TIMP1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 58-207 aa of BC000866 Sequence: YQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA Predict reactive species\nFull Name: TIMP metallopeptidase inhibitor 1\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 23-28 kDa\nGenBank Accession Number: BC000866\nGene Symbol: TIMP1\nGene ID (NCBI): 7076\nRRID: AB_3085910\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01033\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869614002345,"sku":"26847-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26847-1-ap","provider":"Iright","version":"1.0","type":"link"}