{"product_id":"proteintech-26853-1-ap","title":"Proteintech, 26853-1-AP, UPK1B Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe UPK1B (26853-1-AP) by Proteintech is a Polyclonal antibody targeting UPK1B in IHC, ELISA applications with reactivity to human, mouse samples\n26853-1-AP targets UPK1B in IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human urothelial carcinoma tissue, mouse bladder tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nUroplakins are a group of urothelial differentiation-related membrane proteins. They are components of the asymmetric unit membrane (AUM), which forms the apical plaques of mammalian urothelium and is believed to play a role in strengthening the urothelial apical surface thus preventing the cells from rupturing during bladder distention (PMID: 8175808). Uroplakin-1B (UPK1B) belongs to the tetraspanin (TM4SF) family. UPK1B can promote the proliferation, invasion and metastasis of tumor cells and regulate the development and progression of tumors (PMID: 30229818).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25471 Product name: Recombinant human UPK1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 108-229 aa of BC063568 Sequence: TAATQRDFFTPNLFLKQMLERYQNNSPPNNDDQWKNNGVTKTWDRLMLQDNCCGVNGPSDWQKYTSAFRTENNDADYPWPRQCCVMNNLKEPLNLEACKLGVPGFYHNQGCYELISGPMNRH Predict reactive species\nFull Name: uroplakin 1B\nGenBank Accession Number: BC063568\nGene Symbol: UPK1B\nGene ID (NCBI): 7348\nRRID: AB_3085912\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75841\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887917617321,"sku":"26853-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26853-1-ap","provider":"Iright","version":"1.0","type":"link"}