{"product_id":"proteintech-26875-1-ap","title":"Proteintech, 26875-1-AP, H2AFY Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe H2AFY (26875-1-AP) by Proteintech is a Polyclonal antibody targeting H2AFY in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n26875-1-AP targets H2AFY in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, Caco-2 cells,  mouse brain tissue,  HeLa cells,  rat brain\nPositive IHC detected in: human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25445 Product name: Recombinant human H2AFY protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 123-235 aa of BC013331 Sequence: KLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEK Predict reactive species\nFull Name: H2A histone family, member Y\nCalculated Molecular Weight: 372 aa, 40 kDa\nObserved Molecular Weight: 40 kDa\nGenBank Accession Number: BC013331\nGene Symbol: H2AFY\nGene ID (NCBI): 9555\nRRID: AB_2918113\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: O75367\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869691302057,"sku":"26875-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26875-1-ap","provider":"Iright","version":"1.0","type":"link"}