{"product_id":"proteintech-26881-1-ap","title":"Proteintech, 26881-1-AP, HGF Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HGF (26881-1-AP) by Proteintech is a Polyclonal antibody targeting HGF in WB, IHC, IF\/ICC, IF-P, ELISA applications with reactivity to human samples\n26881-1-AP targets HGF in WB, IHC, IF\/ICC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293T cells, A-204 cells,  JAR cells,  HepG2 cells,  NCI-H1299 cells,  U-87 MG cells,  human placenta tissue\nPositive IHC detected in: human liver cancer tissue, human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human liver cancer tissue\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHepatocyte growth factor (HGF) is the most potent mitogen of mature hepatocytes in primary culture. HGF is derived from a biologically inactive single chain precursor of 728 amino acids (pro-HGF) localized mostly on the cell surface and in the extracellular matrix. The mature form produced following proteolytic cleavage is composed of a 69-kDa α-subunit (containing four kringle domains) and the 34 kDa β-subunit, similar to the catalytic domain of serine proteases, but with amino acid substitutions in the active site. HGF is a pleiotropic cytokine which exerts a variety of effects on several cells, being involved in the regulation of many biological processes, such as inflammation, tissue repair, morphogenesis, angiogenesis, tumour propagation, immunomodulation of viral infections and cardio-metabolic activities.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25456 Product name: Recombinant human HGF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 118-157 aa of BC130286 Sequence: LYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP Predict reactive species\nFull Name: hepatocyte growth factor (hepapoietin A; scatter factor)\nObserved Molecular Weight: 69 kDa\nGenBank Accession Number: BC130286\nGene Symbol: HGF\nGene ID (NCBI): 3082\nRRID: AB_2880668\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P14210\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868862763177,"sku":"26881-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26881-1-ap","provider":"Iright","version":"1.0","type":"link"}