{"product_id":"proteintech-26910-1-ap","title":"Proteintech, 26910-1-AP, DUSP7\/PYST2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe DUSP7\/PYST2 (26910-1-AP) by Proteintech is a Polyclonal antibody targeting DUSP7\/PYST2 in WB, IHC, ELISA applications with reactivity to human,  mouse,  rat samples\n26910-1-AP targets DUSP7\/PYST2 in WB, IHC, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat heart tissue,  mouse heart tissue,  mouse kidney tissue\nPositive IHC detected in: human breast cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHuman dual-specificity phosphatase 7 (DUSP7\/PYST2) is a member of a structurally homologous subfamily of MAP kinase phosphatases. DUSP7 is overexpressed in myeloid leukemia and other malignancies. It is known to bind and dephosphorylate ErkII, and as it, along with the other members of the DUSP family expresses high selectively for MAP kinases. It has been suggested that it functions as a method for selectively activating\/deactivating different members of that family.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25488 Product name: Recombinant human DUSP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 60-102 aa of BC104880 Sequence: IRSIIPNHADKERFATRCKAATVLLYDEATAEWQPEPGAPASV Predict reactive species\nFull Name: dual specificity phosphatase 7\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC104880\nGene Symbol: DUSP7\nGene ID (NCBI): 1849\nRRID: AB_2880681\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q16829\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868996948137,"sku":"26910-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26910-1-ap","provider":"Iright","version":"1.0","type":"link"}