{"product_id":"proteintech-26913-1-ap","title":"Proteintech, 26913-1-AP, CSGALNACT1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CSGALNACT1 (26913-1-AP) by Proteintech is a Polyclonal antibody targeting CSGALNACT1 in WB, IP, ELISA applications with reactivity to human samples\n26913-1-AP targets CSGALNACT1 in WB, IP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-3 cells,  MCF-7 cells\nPositive IP detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCSGalNAcT-1 (chondroitin sulfate N-acetylgalactosaminyltransferase-1), catalyzing the transfer of a GalNAc residue onto the nonreducing end of GlcA, is a key glycosyltransferase for chondroitin sulfate (CS) biosynthesis in cartilage. Abnormal expression of CSGalNAcT-1 in cartilage has been linked to diseases like osteoarthritis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25455 Product name: Recombinant human CSGALNACT1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 89-149 aa of BC060772 Sequence: RSEQLRNGQYQASDAAGLGLDRSPPEKTQADLLAFLHSQVDKAEVNAGVKLATEYAAVPFD Predict reactive species\nFull Name: chondroitin sulfate N-acetylgalactosaminyltransferase 1\nCalculated Molecular Weight: 61 kDa\nObserved Molecular Weight: 61-68 kDa\nGenBank Accession Number: BC060772\nGene Symbol: CSGALNACT1\nGene ID (NCBI): 55790\nRRID: AB_2880682\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TDX6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869528346793,"sku":"26913-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26913-1-ap","provider":"Iright","version":"1.0","type":"link"}