{"product_id":"proteintech-26940-1-ap","title":"Proteintech, 26940-1-AP, PDGFA Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PDGFA (26940-1-AP) by Proteintech is a Polyclonal antibody targeting PDGFA in WB, ELISA applications with reactivity to human, mouse, rat samples\n26940-1-AP targets PDGFA in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, rat kidney tissue,  mouse kidney tissue,  rat brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPDGFA is a member of the platelet-derived growth factor family. Four members of this family are mitogenic factors for cells of mesenchymal origin, and they are characterized by a motif of eight cysteines. PDGFA plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, and chemotaxis. It is also required for normal lung alveolar septum formation during embryogenesis, development of the gastrointestinal tract, and spermatogenesis. PDGFA is also involved in oligodendrocyte development and the myelination process in the spinal cord and cerebellum. PDGF-A protein monomer is about 13-16 kDa, and PDGF-AA is a 28.5 kDa A chain homodimer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25643 Product name: Recombinant human PDGFA protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 135-196 aa of BC146594 Sequence: TSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTDVR Predict reactive species\nFull Name: platelet-derived growth factor alpha polypeptide\nCalculated Molecular Weight: 196 aa, 22 kDa\nObserved Molecular Weight: 13-16 kDa\nGenBank Accession Number: BC146594\nGene Symbol: PDGFA\nGene ID (NCBI): 5154\nRRID: AB_3669576\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P04085\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887755219113,"sku":"26940-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26940-1-ap","provider":"Iright","version":"1.0","type":"link"}