{"product_id":"proteintech-26941-1-ap","title":"Proteintech, 26941-1-AP, JAM-A\/CD321 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe JAM-A\/CD321 (26941-1-AP) by Proteintech is a Polyclonal antibody targeting JAM-A\/CD321 in WB, IHC, ELISA applications with reactivity to human samples\n26941-1-AP targets JAM-A\/CD321 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HUVEC cells, human peripheral blood platelets,  U-87 MG cells\nPositive IHC detected in: human breast cancer tissue, human spleen tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe F11 receptor (F11R) was first identified in human platelets as a 32\/35 kDa protein duplex that serves as the receptor for a functional antibody that activates platelets. It seems to play a role in epithelial tight junction formation. It was also reported to function as a receptor for reovirus and ligand for the integrin LFA1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25641 Product name: Recombinant human F11R protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-162 aa of BC001533 Sequence: SVTVHSSEPEVRIPENNPVKLSCAYSGFSSPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGEVKVKLIVLVPPSKPTVNIPSSATIGNRAVLTCSEQDGSPPS Predict reactive species\nFull Name: F11 receptor\nCalculated Molecular Weight: 33 kDa\nObserved Molecular Weight: 33 kDa\nGenBank Accession Number: BC001533\nGene Symbol: F11R\nGene ID (NCBI): 50848\nRRID: AB_2880692\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y624\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869699756201,"sku":"26941-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26941-1-ap","provider":"Iright","version":"1.0","type":"link"}