{"product_id":"proteintech-26950-1-ap","title":"Proteintech, 26950-1-AP, GNRH1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe GNRH1 (26950-1-AP) by Proteintech is a Polyclonal antibody targeting GNRH1 in IHC, ELISA applications with reactivity to human, mouse, rat samples\n26950-1-AP targets GNRH1 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: human brain tissue, mouse brain tissue,  rat brain tissue,  human testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat, pig\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25667 Product name: Recombinant human GNRH1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-92 aa of BC126463 Sequence: QHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI Predict reactive species\nFull Name: gonadotropin-releasing hormone 1 (luteinizing-releasing hormone)\nCalculated Molecular Weight: 92 aa, 10 kDa\nGenBank Accession Number: BC126463\nGene Symbol: GNRH1\nGene ID (NCBI): 2796\nRRID: AB_2880698\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P01148\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868955300009,"sku":"26950-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26950-1-ap","provider":"Iright","version":"1.0","type":"link"}