{"product_id":"proteintech-26958-1-ap","title":"Proteintech, 26958-1-AP, SLC2A12 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe SLC2A12 (26958-1-AP) by Proteintech is a Polyclonal antibody targeting SLC2A12 in WB, IHC, ELISA applications with reactivity to human, mouse samples\n26958-1-AP targets SLC2A12 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse heart tissue, unboiled mouse heart tissue\nPositive IHC detected in: mouse skeletal muscle tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSLC2A12 encodes glucose transporter type 12 (GLUT12), a basal and insulin-independent glucose transporter in the heart with previously reported associations with idiopathic dilated cardiomyopathy in humans, as well as insulin resistance and kidney disease in animal models (PMID: 37081215).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24979 Product name: Recombinant human SLC2A12 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 550-617 aa of BC070149 Sequence: PETKGCSLEQISMELAKVNYVKNNICFMSHHQEELVPKQPQKRKPQEQLLECNKLCGRGQSRQLSPET Predict reactive species\nFull Name: solute carrier family 2 (facilitated glucose transporter), member 12\nCalculated Molecular Weight: 617 aa, 67 kDa\nObserved Molecular Weight: 67-70 kDa\nGenBank Accession Number: BC070149\nGene Symbol: SLC2A12\nGene ID (NCBI): 154091\nRRID: AB_3085917\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q8TD20\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869765783721,"sku":"26958-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26958-1-ap","provider":"Iright","version":"1.0","type":"link"}