{"product_id":"proteintech-26974-1-ap","title":"Proteintech, 26974-1-AP, ELMO1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe ELMO1 (26974-1-AP) by Proteintech is a Polyclonal antibody targeting ELMO1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n26974-1-AP targets ELMO1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse spleen tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: K-562 cells, Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nELMO1 (Engulfment and cell motility protein 1) is a cytoplasmic adapter protein that physically associates with members of the Dock-A family of Rac-GEFs, of which Dock1 and Dock2 are the best characterized (PMID: 24821968). ELMO1 is expressed in platelets and negatively regulates integrin-mediated platelet spreading. Upregulated ELMO1 expression is associated with a poor prognosis in hepatocellular carcinoma (HCC), as well as increased cell growth, invasion, migration, angiogenesis and EMT in vitro and in vivo (PMID: 31324602).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25635 Product name: Recombinant human ELMO1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 76-158 aa of BC114341 Sequence: RLTTSPAQNAQQLHERIQSSSMDAKLEALKDLASLSRDVTFAQEFINLDGISLLTQMVESGTERYQKLQKIMKPCFGDMLSFT Predict reactive species\nFull Name: engulfment and cell motility 1\nObserved Molecular Weight: 80~84 kDa\nGenBank Accession Number: BC114341\nGene Symbol: ELMO1\nGene ID (NCBI): 9844\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q92556\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887500939433,"sku":"26974-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26974-1-ap","provider":"Iright","version":"1.0","type":"link"}