{"product_id":"proteintech-26985-1-ap","title":"Proteintech, 26985-1-AP, Calpain 7 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe Calpain 7 (26985-1-AP) by Proteintech is a Polyclonal antibody targeting Calpain 7 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n26985-1-AP targets Calpain 7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: mouse brain tissue, HeLa cells,  rat brain tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalpains are ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. The calpain proteins are heterodimers consisting of an invariant small subunit and variable large subunits. The large subunit possesses a cysteine protease domain, and both subunits possess calcium-binding domains. Calpains have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain 7 (also known as PalBH) is a mammalian homologue of the Aspergillus, atypical calpain PalB. It is a unique intracellular cysteine protease that has a tandem repeat of microtubule interacting and trafficking (MIT) domains and lacks a penta-EF-hand domain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25574 Product name: Recombinant human CAPN7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC056202 Sequence: MDATALERDAVQFARLAVQRDHEGRYSEAVFYYKEAAQALIYAEMAGSSLENIQEKITEYLERVQALHSAVQSKSADPLKSKHQLDLERAHFLVTQAFDEDEKENVEDAIELYTEAVDLCLKTSYETADKVLQNKLKQLARQALDRAEALGEPLTKPVGKISSTSVKPKPPPERAHFPLGANPFLERPQSFISPQSCDAQGQRYTAEEIEVLRTTSKINGIEYVPFMNVDLRERFAYPMPFCDRWGKLPLSPKQKTTFSKWVRPEDLTNNPTMIYTVSSFSIKQTIVSDCSFVASLAISA Predict reactive species\nFull Name: calpain 7\nCalculated Molecular Weight: 93 kDa\nObserved Molecular Weight: 92 kDa\nGenBank Accession Number: BC056202\nGene Symbol: Calpain 7\nGene ID (NCBI): 23473\nRRID: AB_2880713\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q9Y6W3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869448786089,"sku":"26985-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26985-1-ap","provider":"Iright","version":"1.0","type":"link"}