{"product_id":"proteintech-26999-1-ap","title":"Proteintech, 26999-1-AP, CITED1 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe CITED1 (26999-1-AP) by Proteintech is a Polyclonal antibody targeting CITED1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications with reactivity to human, mouse, rat samples\n26999-1-AP targets CITED1 in WB, IHC, IF\/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: rat testis tissue, A375 cells,  mouse testis tissue\nPositive IP detected in: A375 cells\nPositive IHC detected in: human colon cancer tissue, human thyroid cancer tissue,  rat testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\nPositive FC (Intra) detected in: HEK-293T cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:300-1:1200\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCITED1, also named as MSG1, belongs to the CITED family. CITED1 is a bifunctional transcriptional cofactor which is able to activate or repress transcription in association with other transcription factors. The CITED1 gene encodes a 27 kDa protein, but a 30 kDa band was also detected in the publication.  The elevation of CITED1 may be directly associated with the preneoplastic phenotype (PMID: 23935526, 15272279, 15843474).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, rabbit\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag24643 Product name: Recombinant human CITED1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC004240 Sequence: MPTTSRPALDVKGGTSPAKEDANQEMSSVAYSNLAVKDRKAVAILHYPGVASNGTKASGAPTSSSGSPIGSPTTTPPTKPPSFNLHPAPHLLASMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSD Predict reactive species\nFull Name: Cbp\/p300-interacting transactivator, with Glu\/Asp-rich carboxy-terminal domain, 1\nCalculated Molecular Weight: 27 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC004240\nGene Symbol: CITED1\nGene ID (NCBI): 4435\nRRID: AB_2880718\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q99966\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46869525102761,"sku":"26999-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-26999-1-ap","provider":"Iright","version":"1.0","type":"link"}