{"product_id":"proteintech-27002-1-ap","title":"Proteintech, 27002-1-AP, HOXC13 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe HOXC13 (27002-1-AP) by Proteintech is a Polyclonal antibody targeting HOXC13 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n27002-1-AP targets HOXC13 in WB, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, NCCIT cells\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nHOXC13 is a member of HOX proteins. The HOX family includes 39 paralogous proteins expressed from the HOXA, HOXB, HOXC, and HOXD gene clusters, and these function early in embryonic development to establish cell and tissue identity and to regulate cell proliferation, differentiation, and survival (PMID: 30974835). Human HOXC13, which is expressed in the hair follicle and nail matrix, is involved in the regulation of keratin gene expression (PMID: 11714694). Mutations in human HOXC13 cause ectodermal dysplasia 9, a severe defect of hair and nails (PMID: 23063621).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25544 Product name: Recombinant human HOXC13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-165 aa of BC090850 Sequence: MTTSLLLHPRWPESLMYVYEDSAAESGIGGGGGGGGGGTGGAGGGCSGASPGKAPSMDGLGSSCPASHCRDLLPHPVLGRPPAPLGAPQGAVYTDIPAPEAARQCAPPPAPPTSSSATLGYGYPFGGSYYGCRLSHNVNLQQKPCAYHPGDKYPEPSGALPGDDL Predict reactive species\nFull Name: homeobox C13\nCalculated Molecular Weight: 35 kDa, 330 aa\nObserved Molecular Weight: 38 kDa\nGenBank Accession Number: BC090850\nGene Symbol: HOXC13\nGene ID (NCBI): 3229\nRRID: AB_3669580\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P31276\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887670546601,"sku":"27002-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27002-1-ap","provider":"Iright","version":"1.0","type":"link"}