{"product_id":"proteintech-27024-1-ap","title":"Proteintech, 27024-1-AP, PRPS2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe PRPS2 (27024-1-AP) by Proteintech is a Polyclonal antibody targeting PRPS2 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse samples\n27024-1-AP targets PRPS2 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A375 cells\nPositive IP detected in: A375 cells, mouse spleen tissue\nPositive IHC detected in: human stomach tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A375 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPRPS (phosphoribosyl pyrophosphate synthetase) proteins catalyze the synthesis of phosphoribosyl pyrophosphate (PRPP). Three human PRPS isoforms exist and are encoded by three different genes. PRPS1 and PRPS2 (also known as PRS1 and PRS2, respectively) are ubiquitously expressed, while PRPS3 (also known as PRPS1L1) is specific to the testis. PRPP is an important substrate synthesized from MgATP and ribose-5-phosphate in a reaction that requires inorganic phosphate and magnesium as a cofactor. PRPP is essential in the synthesis of nearly all nucleotides, implying that PRPS proteins play an important role in nucleotide biosynthesis and purine metabolism. PRPS2 is a 318 amino acid protein that exists as a homodimer and a hexamer composed of three homodimers.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25785 Product name: Recombinant human PRPS2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 143-273 aa of BC119662 Sequence: IPVDNLYAEPAVLQWIRENIAEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAVV Predict reactive species\nFull Name: phosphoribosyl pyrophosphate synthetase 2\nObserved Molecular Weight: 30-34 kDa\nGenBank Accession Number: BC119662\nGene Symbol: PRPS2\nGene ID (NCBI): 5634\nRRID: AB_2880726\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: P11908\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46868987183273,"sku":"27024-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27024-1-ap","provider":"Iright","version":"1.0","type":"link"}