{"product_id":"proteintech-27049-1-ap","title":"Proteintech, 27049-1-AP, XKRX Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe XKRX (27049-1-AP) by Proteintech is a Polyclonal antibody targeting XKRX in WB, IHC, ELISA applications with reactivity to human samples\n27049-1-AP targets XKRX in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue\nPositive IHC detected in: human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nXKRX (XK-associated X-linked protein) is a component of the XK\/Kell complex in the Kell blood group system, encoding a membrane protein with multiple transmembrane domains that is exposed on the cell surface and may function as a membrane transport protein. It is expressed predominantly in the placenta and syncytiotrophoblasts. It has 2 isoforms, with molecular weights of 52 kDa and 28 kDa respectively. Its function has not been fully clarified yet.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25266 Product name: Recombinant human XKRX protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 101-210 aa of BC137010 Sequence: VHRDLAKDKPLSLFMHLILLGPVIRCLEAMIKYLTLWKKEEQEEPYVSLTRKKMLIDGEEVLIEWEVGHSIRTLAMHRNAYKRMSQIQAFLGSVPQLTYQLYVSLISAEV Predict reactive species\nFull Name: XK, Kell blood group complex subunit-related, X-linked\nCalculated Molecular Weight: 462 aa, 54 kDa\nObserved Molecular Weight: 30 kDa\nGenBank Accession Number: BC137010\nGene Symbol: XKRX\nGene ID (NCBI): 402415\nRRID: AB_2880732\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q6PP77\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887925022889,"sku":"27049-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27049-1-ap","provider":"Iright","version":"1.0","type":"link"}