{"product_id":"proteintech-27068-1-ap","title":"Proteintech, 27068-1-AP, FGD2 Polyclonal antibody","description":"Size: 20ul \/ 150ul\nThe FGD2 (27068-1-AP) by Proteintech is a Polyclonal antibody targeting FGD2 in WB, IHC, ELISA applications with reactivity to human samples\n27068-1-AP targets FGD2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells\nPositive IHC detected in: human tonsillitis tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nFGD2 is a member of the formin family of proteins, which are known for their role in regulating the assembly of actin filaments. Formins are characterized by their ability to nucleate and elongate actin filaments, and they play a crucial role in processes that require dynamic actin structures, such as cell motility and cell division. Mutations or alterations in FGD2 have been associated with certain developmental disorders and diseases. For example, mutations in FGD2 are a cause of faciogenital dysplasia (Aarskog-Scott syndrome), a condition characterized by facial and genital abnormalities and short stature.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Rabbit \/ IgG\nClass: Polyclonal\nType: Antibody\nImmunogen: CatNo: Ag25782 Product name: Recombinant human FGD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of BC023645 Sequence: MKGASEEKLASVSNLVTVFENSRTPEAAPRGHRLEDVHHRPECRPPESPGPREKTNVGEAVGSEPRTVSRRYLNSLKNKLSSEAWRKSCQPVTLSGSGTQEPEKKIVQELLETEQAYVARLHL Predict reactive species\nFull Name: FYVE, RhoGEF and PH domain containing 2\nCalculated Molecular Weight: 655 aa, 75 kDa\nObserved Molecular Weight: 75 kDa\nGenBank Accession Number: BC023645\nGene Symbol: FGD2\nGene ID (NCBI): 221472\nRRID: AB_2880740\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Antigen affinity purification\nUNIPROT ID: Q7Z6J4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887638827177,"sku":"27068-1-AP","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/products\/proteintech-27068-1-ap","provider":"Iright","version":"1.0","type":"link"}